SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4DHJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4DHJ6
Domain Number 1 Region: 75-127,246-340,376-535
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-56
Family Capz alpha-1 subunit 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4DHJ6
Sequence length 551
Comment (tr|Q4DHJ6|Q4DHJ6_TRYCC) Putative F-actin capping protein alpha subunit isoform 1 {ECO:0000313|EMBL:ABF13415.1} KW=Complete proteome; Reference proteome OX=353153 OS=Trypanosoma cruzi (strain CL Brener). GN=Tc00.1047053506181.90 OC=Schizotrypanum.
Sequence
MEGHLDTFYVPLCWFLSPPLASLFLFFLFFLLAPIYHAFCTLSCSMYADGGGTASRSCGA
VSMSSRESAVKETVDPADILRQFILAAPPGELTSVLKALRVLTGDDRLFFEVVPRLCMEH
HMRHLTPFTLAAPYAKRHESKVRFVDPQSCANVAGSHVSFLAGRQNHLVTRIKRFAKIRR
LQAREVTARVEEYFLQQRSTITPTSANFKQGIYQSVELDDSTGESSASGQSQAPQQQQQQ
QQQQQQELFDPFADILPSEGFDELNHVFFDVALQLYIEVDPVAQLCVRVIPFTSAVAPTM
PEVLREIERQATGLHGGPLGHTRFLLQQEISRYVQACFGEEAEETAMQAERGMSHLMGSA
RNLVDIHHRTSIASAGGMAVLQPHSHSGGEDCQSLVIAVAAVRQFPRNMWSGRWKSIFVV
EPTKDTSSEAQVYIKGETQVYAHYYEDGNMHLEVAQELPLTLLPEWPVEIFTAGGDPTGL
PDAWDLCAAVMAVIQQHEQRIHDAVLKTARDSGDRALRDLRRRLPITKQLFNFRGGQALP
RPMFTSTALEN
Download sequence
Identical sequences Q4DHJ6
psu|Tc00.1047053506181.90 XP_813849.1.87722 gi|71650297|ref|XP_813849.1| gi|93360042|gb|ABF13415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]