SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4EAP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4EAP6
Domain Number - Region: 83-111
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.00667
Family ERP29 C domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4EAP6
Sequence length 141
Comment (tr|Q4EAP6|Q4EAP6_9RICK) Uncharacterized protein {ECO:0000313|EMBL:EAL58515.1} KW=Complete proteome OX=307502 OS=Wolbachia endosymbiont of Drosophila ananassae. GN=WwAna0874 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MDPKNDISFKRIFGTEKNKDILIHFLNDILGFAGTNAIQDIEFLSTIQDPDIASKKQSIV
DVLCRDKNGLQVIVEMVRPESLRSYCLKGEEFIQKETERILKLIEPDVLPSESTHQCELG
NQLVPSDADNEPPLDKEDAQS
Download sequence
Identical sequences Q4EAP6
WP_007549561.1.12093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]