SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4I2D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4I2D7
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-86
Family Capz alpha-1 subunit 0.00000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4I2D7
Sequence length 273
Comment (sp|Q4I2D7|CAPZA_GIBZE) F-actin-capping protein subunit alpha KW=Complete proteome; Reference proteome OX=229533 OS=(Wheat head blight fungus) (Fusarium graminearum). GN=CAP1; OC=Fusarium.
Sequence
MSDIETVSSFVEGAPPGELADVIADIKSLTLETNPDIVNSLTPAFEKYNEEQFVTVKLPG
SSQPVIISSYNSLGDGRYFDVESSSSFTFDHTTQKASAVQSHVLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYILDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTISSANGAGIVREISAMEKRYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGNGGSRR
Download sequence
Identical sequences Q4I2D7
FGSG_08621T0 XP_011320123.1.100342 5518.FG08621.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]