SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4K6M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4K6M4
Domain Number - Region: 164-224
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz beta-1 subunit 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4K6M4
Sequence length 293
Comment (tr|Q4K6M4|Q4K6M4_PSEF5) Probable queuosine precursor transporter {ECO:0000256|HAMAP-Rule:MF_02088} KW=Complete proteome; Reference proteome OX=220664 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5). GN=PFL_5030 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTAYEGDIENSKYKLLGFENNKNLAVIMIIDTGKVIKIKLSEVVNSEIMDNLNKMEVKNL
YKKFYSQGGTLTAYDLNDRNENSWMIYIILNLLLFTFYIFTSIAATKPIYLESLDIIITP
GTFLYPLTFLIVDLLNENFGLRLARRAILFAFASNAMIIILLYASTFLPGLPGWKLDTAY
NDVIIQVSSVLVASSVSFLVSENINSYLLCKIKELTNSRFLFLRIFLSTLFAVIIDSFVF
CYIAFYGAMQNNDILNMIYVQIAIKVCFAFFNILPAYGARSLFKRYITDSQAK
Download sequence
Identical sequences Q4K6M4
WP_011063280.1.11424 WP_011063280.1.14038 WP_011063280.1.1721 WP_011063280.1.18072 WP_011063280.1.21308 WP_011063280.1.41899 WP_011063280.1.42693 WP_011063280.1.462 WP_011063280.1.6225 WP_011063280.1.67749 gi|70732353|ref|YP_262109.1| 220664.PFL_5030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]