SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RF38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RF38
Domain Number 1 Region: 48-183
Classification Level Classification E-value
Superfamily Stathmin 1.12e-55
Family Stathmin 0.000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4RF38
Sequence length 188
Comment (tr|Q4RF38|Q4RF38_TETNG) Stathmin {ECO:0000256|RuleBase:RU004388} OX=99883 OS=nigroviridis). GN=GSTENG00035497001 OC=Tetraodon.
Sequence
MTLAAYKEKVKELPLVSLFCACLNPQTLENPTYKAEDAVDLGWCVIKDVEVIELNKRASG
QAFEVILKPPSFDGVPELNTSMPQRRDPSLEEIQKKLEAAEERRKCQEAELLKHLAEKRE
HEREVIQKAFEENNNFIKNAKEKLEQKMEAIKENREALLAAMLERLQEKDKHAEEVRKNK
EMKEEACR
Download sequence
Identical sequences Q4RF38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]