SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4RII6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RII6
Domain Number 1 Region: 8-100,130-202
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-56
Family Capz alpha-1 subunit 0.000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4RII6
Sequence length 271
Comment (tr|Q4RII6|Q4RII6_TETNG) Chromosome 11 SCAF15043, whole genome shotgun sequence {ECO:0000313|EMBL:CAG11796.1} OX=99883 OS=nigroviridis). GN=GSTENG00033869001 OC=Tetraodon.
Sequence
EFNEVFNVRLPNTTWTSSFLPKLTDTTIRHVLITEHGDLGNGRFFDPHNKISFKFDHLRK
QASDPQPHQGEESLSSWRDACESALKDYVTQHYPSGVCTVRTLAQSAPLSERRPPRTNHA
CVLLYLLQVYGKTIDGQRTIIACIEGHQFEPKNFWNGRCRSEWKFSVSQSTAQLVGVMKI
QVHYYEDGNVQLVSPKCHNVFLFCYIWFCRWPSARTIRPCQTPPSKPYADNCQSPAARWI
GPRSSVIRLEKRCRMLRTSKIVYSIFCFKKE
Download sequence
Identical sequences Q4RII6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]