SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4UFG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4UFG3
Domain Number - Region: 6-60
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0209
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4UFG3
Sequence length 73
Comment (tr|Q4UFG3|Q4UFG3_THEAN) Uncharacterized protein {ECO:0000313|EMBL:CAI74153.1} KW=Complete proteome; Reference proteome OX=5874 OS=Theileria annulata. GN=TA15355 OC=Theileriidae; Theileria.
Sequence
MKKSKENEELWEERKKLVNEILKDYTSNVNECLKIKVNSTHSINTIIVNSKGILNFFQDF
YELFHQNSSNAIT
Download sequence
Identical sequences Q4UFG3
XP_951885.1.9581 5874.Q4UFG3 TA15355 gi|84994326|ref|XP_951885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]