SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4V1J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4V1J8
Domain Number - Region: 26-135
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00942
Family Capz beta-1 subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4V1J8
Sequence length 146
Comment (tr|Q4V1J8|Q4V1J8_BACCZ) Uncharacterized protein {ECO:0000313|EMBL:AAY60409.1} KW=Complete proteome OX=288681 OS=Bacillus cereus (strain ZK / E33L). GN=pE33L466_0252 OC=Bacillus cereus group.
Sequence
MEIMNKILSDFADINADEYVSNYYELSIMSENKKDNIFELAKKATYATSNDILELICLKE
WKKEFLICQYPNGESSWFGRIPYGYDLNGLTPKEFIIEQLLNVFKQEPDEVYWIKLDPGG
YYACCYEEYLFKTNKGIYFFSMQVHD
Download sequence
Identical sequences Q4V1J8
gi|67078127|ref|YP_245747.1| WP_000404911.1.29451 WP_000404911.1.30336 288681.pE33L466_0252 gi|67078127|ref|YP_245747.1|NC_007103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]