SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4WKB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4WKB4
Domain Number 1 Region: 42-299
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.27e-85
Family Capz beta-1 subunit 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4WKB4
Sequence length 322
Comment (sp|Q4WKB4|CAPZB_ASPFU) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=330879 OS=A1100) (Aspergillus fumigatus). GN=cap2; OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPPPLSPRARTLVGQVKRNVQFHVELHQYNTNPTPHTMADIQFDSALDLLRRLNPRDTKQ
NLQAITSIVPDLTEDLLSSVDQPLEIRRCPKTNRDYLLCDYNRDGDSYRSPWSNEFDPPL
EDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVYFWDLDDGFAGVILLKKGVTPGAK
SSGEWDSIHVFEATDRARMSHYKLTSTVILHLANENEALGEMDLSGNMTRQMEVDLPVES
DASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGELRSKPLLCHGRTKAMDADKNTGL
APLSETNKEKAAHLEMIRSMQR
Download sequence
Identical sequences Q4WKB4
XP_750056.1.65241 Afu1g03060 5085.CADAFUAP00009034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]