SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4WMF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4WMF7
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-77
Family Capz alpha-1 subunit 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4WMF7
Sequence length 276
Comment (sp|Q4WMF7|CAPZA_ASPFU) F-actin-capping protein subunit alpha KW=Complete proteome; Reference proteome OX=330879 OS=A1100) (Aspergillus fumigatus). GN=cap1; OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSSTVELASSFIEGAPPGEALTSDGSDIIPSLAPAFERYNEKQLTTVKLPGASQEVIVSE
FNKIEGNRYFDVESQTSFGVDHVTQQASGAQSYVLESQNADLIHVEVHSRSNQCSKSLLK
SLAKHAAEHYPNCSYGVYPTEDDTAVAILLVANRYSPNNFWNGRFRSIYRVPVSESTTVS
GKILVDVHYYEDGNVALNTNKPINIAIPSISAESIISRIAAAERDYQEELNRAFVQMAEG
AFKNLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences Q4WMF7
Afu6g10060 XP_750895.1.65241 5085.CADAFUAP00001906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]