SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4XEF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4XEF0
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-62
Family Capz alpha-1 subunit 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4XEF0
Sequence length 251
Comment (tr|Q4XEF0|Q4XEF0_PLACH) F-actin capping protein, alpha subunit, putative {ECO:0000313|EMBL:CAH84718.1} KW=Complete proteome; Reference proteome OX=5825 OS=Plasmodium chabaudi. GN=PC301202.00.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKNCFILFNFQIIICKQSKNGNLYLHPNLKILANVNHLKRKVVDTTPLAKFDYSDILEKY
RQACNIKLKEYVDIYYKKWSEHQTENYPTVNIGSKHGLNVKCTSSVYASESENKYNLFLI
ICCDRYYLKNFHASSWRSSWDVKFLETDQEIPLTGTIDVVLTYFEDANINFKTQKVFEKR
VSVTNDVESFASSILSVIRECENDVLYDLNHFIANTSNGLIKNTRKIIPLNGDKFYWMET
YQDIPTQIKLI
Download sequence
Identical sequences Q4XEF0
gi|56518044|emb|CAH84718.1| gi|70939739|ref|XP_740374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]