SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4XJG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4XJG5
Domain Number 1 Region: 6-63
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000134
Family ERP29 N domain-like 0.047
Further Details:      
 
Weak hits

Sequence:  Q4XJG5
Domain Number - Region: 44-102
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0471
Family Capz alpha-1 subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4XJG5
Sequence length 137
Comment (tr|Q4XJG5|Q4XJG5_PLACH) Uncharacterized protein {ECO:0000313|EMBL:CAH82949.1} KW=Complete proteome; Reference proteome OX=5825 OS=Plasmodium chabaudi. GN=PC400614.00.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
NINLKEYIFAYIDGKYYEENLELYGVDSKRYPQILVFSKNPREYYFEDYFNIDHVQNIIE
DIENKRIKPKMEELLIKIKKQIKYIIDKSFRTDIKSFIGFICGIIMIVFTVVLVFHTAYS
FVNKPEPEYEMETKKKK
Download sequence
Identical sequences Q4XJG5
gi|56515853|emb|CAH82949.1| gi|70936282|ref|XP_739108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]