SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q50I24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q50I24
Domain Number - Region: 66-104
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0141
Family ERP29 C domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q50I24
Sequence length 133
Comment (tr|Q50I24|Q50I24_BPT2) Trna.1 protein {ECO:0000313|EMBL:CAI54241.1} OX=36337 OS=Enterobacteria phage T2L. GN=trna.1 OC=Tevenvirinae; T4virus.
Sequence
MNGYWWKSTGKYDKRGRKGHEYCMCRFGDKGPYSLNNIYCATNNQNTKDARLNDRFPPKS
KNFNFNGRKHSAQSLEKISKNNASTLSKDEITRRLKILENFNMDERGFIKNYANAINVSH
TQARKFLNKYYIK
Download sequence
Identical sequences Q50I24
Q50I24_BPT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]