SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q55Y29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55Y29
Domain Number 1 Region: 5-288
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.02e-77
Family Capz beta-1 subunit 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q55Y29
Sequence length 293
Comment (tr|Q55Y29|Q55Y29_CRYNB) Uncharacterized protein {ECO:0000313|EMBL:EAL22737.1} KW=Complete proteome OX=283643 OS=(Filobasidiella neoformans). GN=CNBB1850 OC=Cryptococcus neoformans species complex.
Sequence
MADPDQTFDALLDLLRRLPPTRVEENVNALCDLAPEYADDLLGNVDQPLKVLVDEEKARE
FLGCDYNRDGDSFRSPWTNNYLPEPVPGPTPSPRLRELEIQLNAAFDTYREMYFEGGVSS
VYLWDLDDEPQGKEMNFAGVVLVKKTLQSQSGVPTAPAGSWDSLHVFECHERGRSAKYKL
TSTVMLVLETATLAKAENKGLEDSDGKGGVTLSGSMTRQAEIDYPLTTPQGHISNIGRIV
EDMEIKMRNLLSAVYFGKTKDVINDLRSQSGLEAKSKEDLLRAELAGKLGGRK
Download sequence
Identical sequences Q55Y29
sgtc|cn02187 XP_777384.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]