SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q58FE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q58FE4
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily IpaD-like 1.44e-52
Family IpaD-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q58FE4
Sequence length 156
Comment (tr|Q58FE4|Q58FE4_SALGL) SipD {ECO:0000313|EMBL:AAX49616.1} OX=594 OS=Salmonella gallinarum. GN=sipD OC=Enterobacteriaceae; Salmonella.
Sequence
SKMGGWLLPGKDGNTVKLDVTSLKNDLNSLVNKYNQINSNTVLFPAQSGSGVKVATEAEA
RQWLSELNLPNSCLKSYGSGYVVTVDLTPLQKMVQDIDGLGAPGKDSKLEMDNAKYQAWQ
SGFKAQEENMKTTLQTLTQKYSNANSLYDNLVKVLS
Download sequence
Identical sequences Q58FE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]