SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5A893 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5A893
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.11e-71
Family Capz alpha-1 subunit 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5A893
Sequence length 280
Comment (sp|Q5A893|CAPZA_CANAL) F-actin-capping protein subunit alpha KW=Complete proteome; Reference proteome OX=237561 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). GN=CaO19.10745, OC=Candida/Lodderomyces clade; Candida.
Sequence
MSINLNELVDSLIQSAPPAELKQVSQSLSSLTKGTSTSSTNSLIQDSIEQYAQENIISID
NIIISKYNKDENSSKYIDYVNNKLFNVDWQNQKIIDVESYHDNNNKRGSNYDELIQKLSQ
YGDDYYPSNFAFTVIPESEDQLRVIIIGQRANHDNFYTGQWKSNYLITEQGIKGNIDLDI
HYFEDGNVRLKFNESINSSNNNNNSSTLQSGNLINNASRIVNFINEQENATMVKIIEQFN
NLNQKSFKNLRRLLPVTRSKINWGSAIGNYRLGSDVINKK
Download sequence
Identical sequences Q5A893
XP_717926.2.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]