SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5AMP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5AMP9
Domain Number 1 Region: 2-279
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-72
Family Capz beta-1 subunit 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5AMP9
Sequence length 291
Comment (tr|Q5AMP9|Q5AMP9_CANAL) F-actin-capping protein subunit beta {ECO:0000313|EMBL:AOW28966.1} KW=Complete proteome; Reference proteome OX=237561 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). GN=CAALFM_C401950WA OC=Candida/Lodderomyces clade; Candida.
Sequence
MDKFDSSLDLIRRLDPRSITTNLSNICALISEDEELVADLLSSVDTPLTTSTCLKSGKDY
LCCDYNRDGDSYRSPWTNVYYPELSSQDVNDAPYPSSILRDLEIKANDSFDIYRDLYYEG
GISSVYLWDTSEEDEDVDSTTALQNGFAGVVLFKKETEDKSGNWDSIHVFEVVPQSKNKY
LYKLTTSVVLNLENKKQVDGNLGLAGNLTRQLEQEQSIELDGAINPETSHLINLGQLVEK
SEYNIRNLLQEVYFDKLKDIMLKDLRSIGDINDKKLDDLKQNAIIKGLQGL
Download sequence
Identical sequences C4YHQ0 Q5AMP9
CAWT_03599 5476.CAL0002953 CA5159 XP_722669.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]