SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5B3G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5B3G1
Domain Number 1 Region: 5-126,183-217
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 2.09e-36
Family Arp2/3 complex 16 kDa subunit ARPC5 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5B3G1
Sequence length 217
Comment (tr|Q5B3G1|Q5B3G1_EMENI) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=AN4919.2 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSTLNYRTINIDALDPDSPQNFPLTTLLPSTLPPPQGSSDAANTATQVRQLLRSGDPAAA
LIHVLDTAPLGGDEGAKQVHLATVIDVLQGIRQGEMGRVLQAVLDGPGGVERGDCLMKYL
YASPHVSFLIREARVQANYMRWFRYKGMAAGGPSNGAQSPRKSVSPQSTGFSQIQARNLG
EGGGGQQMSVLLNWHEKLVELTGTGSIVRVMTDRRTV
Download sequence
Identical sequences Q5B3G1
XP_662523.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]