SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5BGP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5BGP0
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-88
Family Capz beta-1 subunit 0.0000000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5BGP0
Sequence length 266
Comment (sp|Q5BGP0|CAPZB_EMENI) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=cap2; OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MADAQFDSALDLLRRLNPRDTKQNLQAITSIVPDLTEDLLSSVDQPLEIRRCPKTKRDYL
LCDYNRDGDSYRSPWSNEFDPPLDDGTVPSERVRRLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVILLKKGVSPGGKHSGEWDSIHVFEATDRGRMAHYKLTSTVILHLSNENE
ALGEMDLSGNMTRQIEVDMNVDSDASHVANVGKLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSIGPLSETNRDRATHQEMIRGLQR
Download sequence
Identical sequences Q5BGP0
162425.CADANIAP00002425 ANID_00290T0 XP_657894.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]