SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5C821 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q5C821
Domain Number - Region: 144-193
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0706
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5C821
Sequence length 337
Comment (tr|Q5C821|Q5C821_SCHJA) SJCHGC05697 protein {ECO:0000313|EMBL:AAX24203.2} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MDDRPVTGGGGYKINWDEIDEMSNPFGTGNKGLPAKSQPKTVNKPSAQGDRPNDSIKQQV
NVSADQDPDKLSIKFPQKPQLISKAPSNSNTSTEANQSQNNLSSVVSPTVMNGHDTTKDI
QSENVPQCNGETLEPKISQSFPSPEEICEALQNVIDLQPDDDNSLEVIQDHFDEYYPTSD
ELVENNVDNGNVIPEVMQSSRIDSSTRPASPAQSGMLNKSETPLVNGKENCQLPPQHPFK
SSRDSKSNDTELIALRKERDQLLTTIEEMKHCITEYDRSLQHMVEEKALSQKEVNVPVAD
LIKERDEAVEELATIEKAFGDLHRRFEKSKQIIEGFK
Download sequence
Identical sequences Q5C821
6182.Q5C821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]