SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5E997 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5E997
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-115
Family Capz alpha-1 subunit 0.000000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5E997
Sequence length 286
Comment (sp|Q5E997|CAZA2_BOVIN) CapZ alpha-2 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CAPZA2; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRISFKFDHLRKEATDPRPYEAENAIESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences Q09YJ9 Q5E997
9913.ENSBTAP00000005324 NP_001013016.1.59421 NP_001013016.1.76553 XP_005899195.1.15283 XP_006069752.1.26621 XP_012001490.1.54773 XP_017902677.1.57651 XP_019814283.1.53367 XP_020755510.1.74333 ENSBTAP00000005324 ENSBTAP00000005324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]