SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5FX87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q5FX87
Domain Number - Region: 48-78
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 0.0288
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5FX87
Sequence length 137
Comment (tr|Q5FX87|Q5FX87_9HEPC) Polyprotein {ECO:0000313|EMBL:AAW69540.1} OX=11103 OS=Hepacivirus C. GN= OC=Flaviviridae; Hepacivirus.
Sequence
PFGLLSCLTTPASALTYGNTSGLYHLTNDCPNSSIVLEADAMILHLPGCLPCVRVGNRST
CWHALTPTLAIPNASTPATGFRRHVDLLAGAAVVCSSLYIGDLCGSLFLAGQLFTFQPRR
HWTVQDCNCSIYTGHVT
Download sequence
Identical sequences Q5FX87
Q5FX87_9HEPC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]