SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5KLV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5KLV9
Domain Number 1 Region: 5-288
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.02e-77
Family Capz beta-1 subunit 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5KLV9
Sequence length 293
Comment (tr|Q5KLV9|Q5KLV9_CRYNJ) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:AAW41910.1} KW=Complete proteome; Reference proteome OX=214684 OS=ATCC MYA-565) (Filobasidiella neoformans). GN=CNB03880 OC=Cryptococcus neoformans species complex.
Sequence
MADPDQTFDALLDLLRRLPPTRVEENVNALCDLAPEYADDLLGNVDQPLKVLVDEEKARE
FLGCDYNRDGDSFRSPWTNNYLPEPVPGPTPSPRLRELEIQLNAAFDTYREMYFEGGVSS
VYLWDLDDEPQGKEMNFAGVVLVKKTLQSQSGVPTAPAGSWDSLHVFECHERGRSAKYKL
TSTVMLVLETATLAKAENKGPEDSDGKGGVTLSGSMTRQAEIDYPLTTPQGHISNIGRIV
EDMEIKMRNLLSAVYFGKTKDVINDLRSQSGLEAKSKEDLLRAELAGKLGGRK
Download sequence
Identical sequences Q5KLV9
186.m03828 XP_569217.1.95466 214684.CNB03880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]