SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5TPF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5TPF0
Domain Number 1 Region: 57-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000288
Family Somatomedin B domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5TPF0
Sequence length 84
Comment (tr|Q5TPF0|Q5TPF0_ANOGA) AGAP010796-PA {ECO:0000313|EMBL:EAL39334.3} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP010796 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGVQQYVLFAVLLVPLSALIGGAYGGSCREATLCCNGRDSSCVVQKAPLNAIIEDLNDKP
CYCDHACLKLGDCCDDFKSHCGGK
Download sequence
Identical sequences Q5TPF0
AGAP010796-PA XP_554247.3.40869 7165.AGAP010796-PA AGAP010796-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]