SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5ZLP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5ZLP3
Domain Number 1 Region: 8-199
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-76
Family Capz alpha-1 subunit 0.00000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5ZLP3
Sequence length 199
Comment (tr|Q5ZLP3|Q5ZLP3_CHICK) Uncharacterized protein {ECO:0000313|EMBL:CAG31350.1} OX=9031 OS=Gallus gallus (Chicken). GN=RCJMB04_5f9 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYY
Download sequence
Identical sequences Q5ZLP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]