SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q68U64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q68U64
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily DEATH domain 1.15e-18
Family Pyrin domain, PYD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q68U64
Sequence length 67
Comment (tr|Q68U64|Q68U64_ALOBE) Cryopyrin {ECO:0000313|EMBL:AAR03562.1} OX=30590 OS=Alouatta belzebul (Red-handed howler monkey). GN=CIAS1 OC=Platyrrhini; Atelidae; Alouattinae; Alouatta.
Sequence
VRCKLARYLEDLEDVDFKKFKMHLEDCPPQKGYIPLPRGQTEKADHVDLATLMIDFNGEE
KAWAMAV
Download sequence
Identical sequences Q68U64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]