SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6BV03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q6BV03
Domain Number - Region: 31-126
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0022
Family Capz alpha-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6BV03
Sequence length 147
Comment (tr|Q6BV03|Q6BV03_DEBHA) DEHA2C06446p {ECO:0000313|EMBL:CAG86024.2} KW=Complete proteome; Reference proteome OX=284592 OS=0083 / IGC 2968) (Yeast) (Torulaspora hansenii). GN=DEHA2C06446g OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Debaryomyces.
Sequence
MNTDEPLTSHVRPATDVVLTIRIVKSFPYRNVKNHILPSVNLKETTPSDLIKSLRNIINT
TGGLRPYRNVTYDTLKIYTKAHGSKSMQLVINLDHDDDWVLLCEDTSNPIAGDGKSLYEL
EVENETEISMFNWSDYQEFKQNPEEKW
Download sequence
Identical sequences Q6BV03
4959.Q6BV03 XP_457966.2.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]