SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6BXG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6BXG6
Domain Number 1 Region: 5-292
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-69
Family Capz beta-1 subunit 0.000000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6BXG6
Sequence length 297
Comment (sp|Q6BXG6|CAPZB_DEBHA) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=284592 OS=0083 / IGC 2968) (Yeast) (Torulaspora hansenii). GN=CAP2; OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Debaryomyces.
Sequence
MTSYDDKLDASLDLMRRLDPKNITKNLNDICTLIQNDGSETSEELTQDLLSSVDVPLRTQ
KCDETGKEYLCCDYNRDGDSYRSPWSNKYFPVVAQDSDELPPPFPSNILRELEVKANDSF
DIYRDLYYEGAGTSSVYFWDTNEEDDEQETLDNGFAGVVLFKKETEDGSGKWDSIHVIEV
IPEASSNATYKVTSSVILDLQNKKSSSLSLAGSLTRQLELTQSLSLDSALNVETAHLINL
GTLIEKSEYNLRNLLQDVYFDKLRDIVMKDLRSVGDLSGKESDDKRQSELVKGLQSL
Download sequence
Identical sequences Q6BXG6
XP_457103.2.41535 4959.Q6BXG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]