SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6CPK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6CPK5
Domain Number 1 Region: 4-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.06e-64
Family Capz beta-1 subunit 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6CPK5
Sequence length 279
Comment (sp|Q6CPK5|CAPZB_KLULA) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=284590 OS=1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica). GN=CAP2; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MSVDEKYDAACELLYRLDPTKVKTHLQNLIALEPEIAEGLLSSIDIPLTIKKDTDANNKE
FLCCDYNRDIDSHRSPWSNQYFPELSAEDLKESPFPSEPLRELEVACNNSFELYRDLYYE
GGYTSTYLWDVDESTDFAGVILFKKAESDDSKWDSIHVISATHDEEGMEVTYNVTTTVIL
HLENLSKEQQLSLSGNLTRENSKTVKLQNVSTVEQLVPAHSSSLGSMIEDIESKLRSMLE
IVYFEKTLDIYNVLRERNDDSTKLQKEQHSELIENFQKL
Download sequence
Identical sequences Q6CPK5
gnl|GLV|KLLA0E04225g XP_454134.1.35115 28985.Q6CPK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]