SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6GQ94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6GQ94
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-113
Family Capz alpha-1 subunit 0.000000000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6GQ94
Sequence length 286
Comment (tr|Q6GQ94|Q6GQ94_XENLA) MGC80246 protein {ECO:0000313|EMBL:AAH72853.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18017642mg OC=Xenopus.
Sequence
MADMEEQLSDDEKVRVAAKFIIHAPPGEFNEVFNDVRVLLNNDNLLREGAAHAFAQYNLD
QFTPVKVDGYDEQVLITEHGDLGNGRFLDPKNKISFKFDHLRKEASDPRPSDGENAIESW
RNTVDSAVRSYVKEHYPNGVCTVYGKTIDGHQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTKVFGILKIQVHYYEDGNVQLVSHKDIEESLTVSNEVQTAKEFIKIVEDAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences Q6GQ94
gi|148233786|ref|NP_001085499| gi|49117926|gb|AAH72853| NP_001085499.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]