SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6NWD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6NWD6
Domain Number 1 Region: 5-278
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-114
Family Capz alpha-1 subunit 0.000000000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6NWD6
Sequence length 283
Comment (tr|Q6NWD6|Q6NWD6_DANRE) Si:dkey-16k6.1 protein {ECO:0000313|EMBL:AAH67631.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-16k6.1 OC=Cyprinidae; Danio.
Sequence
FEEPLSDEEKVRIAANFVTHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFT
PVKLDGSEESVLITEHGDLGQGRFFDPRKRVSFRFDHLRKEASDPQPYEGESALRSWRDA
CDDALSAYVKEHYPSGVCTVYGKTVDGQQTIIACIEGHKFEPKNFWNGRCRSEWKFNISQ
SSAQVVGVLKIQVHYYEDGNVQLVSHKEVEESIVVTNEVQTAKEFAKIIENAENDYQTAI
SENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences Q6NWD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]