SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6NWK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6NWK1
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.67e-112
Family Capz alpha-1 subunit 0.000000000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6NWK1
Sequence length 286
Comment (tr|Q6NWK1|Q6NWK1_DANRE) Capping protein (actin filament) muscle Z-line, alpha 1a {ECO:0000313|Ensembl:ENSDARP00000046972} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=capza1 OC=Cyprinidae; Danio.
Sequence
MADFEEQLSDDEKVRIAANFVIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPAKLDGSEDQVLITEHGDLGHGRFFDPRKKQSFKFDHLRKEASEAQSYEGEAALRPW
RDAVDEALRAYVKEHYPSGVCTVYGKTIDGQKTIIACIEGHRFQPQNFWNGRCRSEWKFS
ISQATAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLVISTEVQTAKEFVEIIKNAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences Q6NWK1
ENSDARP00000046972 ENSDARP00000046972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]