SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6SHC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q6SHC5
Domain Number - Region: 7-88
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00051
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6SHC5
Sequence length 167
Comment (tr|Q6SHC5|Q6SHC5_9BACT) Uncharacterized protein {ECO:0000313|EMBL:AAR37695.1} OX=257390 OS=uncultured marine bacterium 440. GN=MBMO_EBAC750-02H05.13 OC=Bacteria; environmental samples.
Sequence
MWVVAKYKPKELETLKDSFCKIVGDKPEFYIPKIMQEYYKNNKLKIIQKNILSNYIICKH
SKFKDLKFISKLNHSRGLIYLLKNSNMNQNNLESFVKFCKSHEDSRGFLRQTFFEITKKT
KAKFISGPLTQMIFNIIEEEGKKLKILLNNVNVTIPKNSSKLLYNYI
Download sequence
Identical sequences Q6SHC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]