SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6U1M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q6U1M0
Domain Number - Region: 179-231
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00889
Family Capz alpha-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6U1M0
Sequence length 399
Comment (tr|Q6U1M0|Q6U1M0_9ASCI) Gap junction protein {ECO:0000256|RuleBase:RU000630} OX=247438 OS=Halocynthia pyriformis (sea peach). GN=Cx47 OC=Pyuridae; Halocynthia.
Sequence
MAWHILHGLLEQVRVQSTFPGKLWIIVMFIFRIVVVARIGDNVYHDEQANFVCNVLTPGC
ENVCFNRFSPISQLRYWSLMILVVSTPAILFFLYATHIIYHAGIKYPSEEDEEKKEIMTT
RSDQSYIHPPSLKRRRDEGFLPNGTTGPLFEVKKIGNSDGKYKTAKFGNNRRSDDIRRRR
HVIRHDGDVKRKLSTDNNESNEEVYIDYRNKVPIFVDPHGQRVEFMKEVHRNRAEDDAMA
ERKFRKRMLEHPELYRAYWWHVFLRTLCEVGFLVGQYYLYGWSVHELYECNYWPCPKTVD
CFVSRPQEKTCLLWLMYVLGIIACLLSVAEFWTLGITRLKYAFLCCSHDESREERRRRLA
LLETHSTHHDKENDPLHPRLITGAMSFDSLSSETTVESV
Download sequence
Identical sequences Q6U1M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]