SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q74L40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q74L40
Domain Number - Region: 144-226
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.016
Family Capz alpha-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q74L40
Sequence length 502
Comment (tr|Q74L40|Q74L40_LACJO) Uncharacterized protein {ECO:0000313|EMBL:AAS08375.1} KW=Complete proteome; Reference proteome OX=257314 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533). GN=LJ_0385 OC=Lactobacillus.
Sequence
MKYFIPAWHKQYDDWSINIPSIENYDAAEYMTVLKKFDEEIGLIITDYQSQLLSKLNQIA
FFPNTLFSVYDFLQGVHGFENKVLELEDFNWPKNAIFDYGPFRTLIVLENKLYATVFYDI
DGHILRISYPENDEHKAFTLGIDSRGFISNQDDEEKTIYFDPYGNWRFKKDKTTDKITVN
PEMHFCKRREYENITDLVDEILSRYLKVNAKNNDEIIVTVDDESSFNNEIIEPYKPLYII
NRHHPYSKKIGSLARAKVIVSSNEIKQNLEKNYREQFDISVIPVFNSEFRLGHSQRQNVQ
EIGFFAENANDENIHQIIQKLCNYILKNPDNYSLKIFTYNFWKADHVNKILEQIKEENKN
SFILGKSEQAENAPIDGLDDEVSLPELDVAHTRLTNISDVLSNLDKMRLLINWGKADELM
QISGVSIGIPQVQNFSSVTVVDNKNGRIIKKISELLPVVDEYLTNLNSWNQTVVYNVQLM
NQYSEENIIEKWKEVFKERKAE
Download sequence
Identical sequences Q74L40
gi|42518479|ref|NP_964409.1| WP_011161544.1.27409 257314.LJ0385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]