SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q759L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q759L4
Domain Number 1 Region: 87-303
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 2 Region: 243-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.88e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Weak hits

Sequence:  Q759L4
Domain Number - Region: 412-504
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz alpha-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q759L4
Sequence length 533
Comment (tr|Q759L4|Q759L4_ASHGO) ADR262Cp {ECO:0000313|EMBL:AAS52182.1} KW=Complete proteome; Reference proteome OX=284811 OS=Y-1056) (Yeast) (Eremothecium gossypii). GN=AGOS_ADR262C OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium.
Sequence
MFARQVVCGGRIAGRRLFANSALRMGPQTAAAATRSVPRRVLGAALKVAGATLLAGTAWV
SYELYRESNPAAQEPQSATFPDGSPRKTLVVLGSGWGSVTLLKNLDTTLYNVVVVSPRNY
FLFTPLLPSTPVGTVELKSIVEPVRSITRRRPGEVIYYEAEALEVDPQSKKVRIRSVEQG
EHKYEMELNYDCLVVGVGAQPTTFGTPGVYEHASFLKEIPDAQDIRVKVMNNIEKAAALS
PNDPERKRLLSFVVVGGGPTGVEFAAELQDYVDQDLSKWMPELSKEIKVTLCEALPNILN
MFDKSLWQYAQDLFKQEKIDLKVNTMVKNVTATHITTKCGDQLEELPYGVLVWATGNAPR
DVSKSLMKKLDQQTSPRGLLINDKLQLLGAEDSIYAMGDCTFYPGLFPTAQVAHQEGEYL
AHVLKKQHKIDHLRWQLADAEPSQVPRITARLEKAEAAIQPFKYNHQGALAYIGSEKAIA
DIAIGESKYRLAGSWTFLFWKSSYLVMCLSFRNRILVALDWLKVSFLGRDSSV
Download sequence
Identical sequences Q759L4
tr|Q759L4|Q759L4_ASHGO 33169.AGOS_ADR262C NP_984358.1.49492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]