SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q75AM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q75AM4
Domain Number 1 Region: 2-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-66
Family Capz beta-1 subunit 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q75AM4
Sequence length 274
Comment (tr|Q75AM4|Q75AM4_ASHGO) ADL101Cp {ECO:0000313|EMBL:AAS51819.1} KW=Complete proteome; Reference proteome OX=284811 OS=Y-1056) (Yeast) (Eremothecium gossypii). GN=AGOS_ADL101C OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium.
Sequence
MSEEKYDAAMDLLRRLDLENLESNLQALIELEPALAADLLSSVDTPLTVKADPSCSGREF
LCCDYNRDIDSHRSPWSNEYFPRLSAEELAESPFPSDALRRLEVLANDSMDIYRDLYYEG
GVSSVYMWSVDDAADDFAGVVLFKKGAQSTSHWDSIHVFEVLHEGSHEVVYRITTTIILR
LKDANAVALSGNLTRQTEKTASLPSGSEERTHITHVTNLGSAIEEVEGQMRNLLEVVYFD
KTKDVYHELRNDAAESLQVNRDKHQDLIKGLQGL
Download sequence
Identical sequences Q75AM4
NP_983995.1.49492 33169.AGOS_ADL101C tr|Q75AM4|Q75AM4_ASHGO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]