SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7MHS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7MHS8
Domain Number 1 Region: 163-300
Classification Level Classification E-value
Superfamily CBS-domain pair 6.57e-25
Family CBS-domain pair 0.005
Further Details:      
 
Domain Number 2 Region: 311-392
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.31e-20
Family CorC/HlyC domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7MHS8
Sequence length 396
Comment (tr|Q7MHS8|Q7MHS8_VIBVY) Putative hemolysin {ECO:0000313|EMBL:BAC95555.1} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=VV2791 OC=Vibrionaceae; Vibrio.
Sequence
MMSLNRYRLKHLANSGHKGAKRVEKLLSRPDRLIGLILIGNNLVNILASAIATILGMRLY
GDLGVAIATGALTLVVLVFAEVTPKTVAALYPERVSYASSILLVVLMKLLSPLVMLVNFI
TNGFIRLLGLKAQHNGEDNLSSEELRTVVNEAGSLIPQRHQDMLVSILDLEHVTVNDIMI
PRNEITGIDINDDWKSIVRQLTHSPHGRIVLYRDKIDEAVGMLRLREAYRLMLEKNEFNK
ETLLRAADEVYFIPESTPLNVQLLKFQRNKQRIGLIVDEYGDIIGLVTLEDILEEIVGEF
TTSIAPSLSDEITPQGDGSFLIEGSTNIRDINKGLKWKLPTDGPRTLNGLILEHLEDIPE
SHLSVKVAGHAMEIVELEENRIKSVKVFPKRKRKTT
Download sequence
Identical sequences Q7MHS8
196600.VV2791 gi|37680975|ref|NP_935584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]