SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7SXP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7SXP1
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.06e-97
Family Capz beta-1 subunit 0.000000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7SXP1
Sequence length 273
Comment (tr|Q7SXP1|Q7SXP1_DANRE) capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:AAH55514.1, ECO:0000313|Ensembl:ENSDARP00000140899} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=capzb OC=Cyprinidae; Danio.
Sequence
MNEQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYEPPIDDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVSESSPHIANIGRLVEEMENKIRSTLNEIYFGKTKDIV
NGLRSVQPLADKTKQEALKNDLIQALSQRKQQS
Download sequence
Identical sequences Q7SXP1
ENSDARP00000067634 NP_956229.1.45394 XP_009294021.1.45394 ENSDARP00000067634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]