SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7VE96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7VE96
Domain Number 1 Region: 108-278
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000000471
Family MoCo biosynthesis proteins 0.011
Further Details:      
 
Domain Number 2 Region: 23-117
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000421
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  Q7VE96
Domain Number - Region: 264-306
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7VE96
Sequence length 465
Comment (tr|Q7VE96|Q7VE96_PROMA) Fe-S oxidoreductase {ECO:0000313|EMBL:AAP99163.1} KW=Complete proteome; Reference proteome OX=167539 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120). GN=Pro_0117 OC=Prochlorococcus.
Sequence
MWKEPSPNSAIPSLTEVTKGYKPDPALIKIVDPGSIGEDLGFEAGDQLLTINGVKPRDLI
DYKYLIAEEELELEVLDKNGERHNIQLEKNLDDDLGLIFTEALFDGLKQCNNNCSFCFID
QQPAGRRQTLYVKDDDYRMSFLYGSYLTLTNLMPKDWERIEAQRLSPLFVSVHATDSKLR
SQLLKNDKAGLIMEQIKWFAEKKLQLHAQIVVCPGINDGKNLAKTINDLFQYAQGTWPAI
ISTAVVPVGLTRFRPDQDGLQPVNEECAKKVISLVERMQTDFQSKIGSRFAWLSDEWYLI
ANKQLPHRVAYEDLPQEENGVGSIRSFLEAMDIVTQHLPKKISKKKTCSWVVGKLVEQAL
SPISLRMNRIEGLSLKVFGLASPYWGKEKVVTGLLTGQDIINGLKNKELGDELLLPSVML
KHDELKFLDDVTVEEVANNLKIPIKIILGPDDFVEHLIGEQENDS
Download sequence
Identical sequences Q7VE96
gi|33239569|ref|NP_874511.1| NP_874511.1.92868 WP_011124272.1.25276 WP_011124272.1.37041 WP_011124272.1.47494 WP_011124272.1.71786 WP_011124272.1.74834 167539.Pro0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]