SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7X0X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7X0X6
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 3.53e-55
Family Staphylokinase/streptokinase 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7X0X6
Sequence length 141
Comment (tr|Q7X0X6|Q7X0X6_STREQ) Streptokinase {ECO:0000313|EMBL:AAP40116.1} OX=119602 OS=equisimilis). GN=skcg OC=Streptococcus.
Sequence
KEKPIQNQAKSVDVEYTVQFKPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSI
LNKTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYEINKKSGLNEEINN
TDLISEKYYVLKKGEKPYDPF
Download sequence
Identical sequences Q7X0X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]