SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q86HR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q86HR8
Domain Number - Region: 134-204
Classification Level Classification E-value
Superfamily Perfringolysin 0.0327
Family Perfringolysin 0.01
Further Details:      
 
Domain Number - Region: 486-549
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q86HR8
Sequence length 748
Comment (tr|Q86HR8|Q86HR8_DICDI) Uncharacterized protein {ECO:0000313|EMBL:EAL70355.1} KW=Complete proteome; Reference proteome OX=44689 OS=Dictyostelium discoideum (Slime mold). GN=DDB0217550 OC=Dictyosteliaceae; Dictyostelium.
Sequence
MIVLLNDYFYSKFGDQANLNVFSNDCFEFPPRVSNLTLLSSNSVTLNSNQTIGWEIVIDS
GGGIKISYVFIHVISNLDKKGYTFEFYPNSTSWETTIGIALSPETTPSQIFKIYNATIID
ERGIRSDHIDSFKVDEIFSNQSPIYPISISPFYLFDLSLFSITVNSPFITESVPPTITLV
TLPFENVDDFLQYSIFFQLVSTDNVGILKSHIPQVYLSHSSNYGDLQIFQCNTAINDTSE
TTCNYYVTCKVEYGYGIQNPVSVLVYGVVDTSFNVASYSSLSESQTFDFNGLSNKKTPSI
SSWTPLTPYNNKLTIFGRNFPTSGGSAYLYYTDSDIDNLVTLKFIHSSSVMAVLEIGQGL
KPFVVYTQNSNNEKSNKVEIHYLGIPTSSSSSSSSSDDDSTLPPVLCFDNCGGTSRGTCI
PNVGCNCKSPYSGINCLSETIKIPKPQTNTTSPDSRNEFPISGSDIKLNTIISIVALREL
DFQGKQVNIHYFDSWNFTTISQTNFTYRSPILKNNQHVSNISVAMEWHEQSTTITFAKQN
LTINPSTLKYYISLDKYPFASSLNTLDLIIKSMFKSSQTDDVCGSKGFSLNDGNDYMTLQ
IGTYSFEGKFIKKAIINGNRIVTINNKLLNENQLNSNSTITKEKDSSNQLSSFISIEIPH
YDSNVLLDPSFSVLLDSNESYKNSENSICTSKKSSKLTTAQIIAIVIVSVVFVIILALFI
IVKFSKSDKFLSIRIFYYKLFKRFKKKY
Download sequence
Identical sequences Q86HR8
XP_644166.1.73096 DDB0217550|DDB_G0274925 44689.DDBDRAFT_0217550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]