SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8H358 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8H358
Domain Number 1 Region: 4-286
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.29e-88
Family Capz alpha-1 subunit 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8H358
Sequence length 297
Comment (tr|Q8H358|Q8H358_ORYSJ) Putative alpha subunit of F-actin capping protein {ECO:0000313|EMBL:BAC20863.1} OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSJNBa0077F02.126 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSDGEEKREIAVWFLSNAPAGEIHYVAKDVRALLGDEAVYEAAAAEAFPEHNKAHLVALE
LPDRSGDIIITTYGELDKNNYLDPRTAQVATVDHIKQKCTKLRPAADEELPSAYIEDFRS
ALDVELSKYVGEAYPKGVCAVYCTSGKDIEGPGVDFRFAAVISAAKRSPQNFCNGNWRSI
WTLEFIDGLQLVEIKGKIQVGAHYFEEGNVQLDTNIDCKDSTILQSPEECAVSITNIIRH
HESEYLSSLEESYMNLSDATFKDLRRKLPVTRTLFPWHNTLALSLTRDLTKELAIGK
Download sequence
Identical sequences Q8H358
39947.LOC_Os07g23200.1 LOC_Os07g23200.1|PACid:21899408 LOC_Os07g23200.1|13107.m02278|protein XP_015645189.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]