SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8I3I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I3I2
Domain Number 1 Region: 4-299
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-75
Family Capz alpha-1 subunit 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8I3I2
Sequence length 307
Comment (tr|Q8I3I2|Q8I3I2_PLAF7) F-actin-capping protein subunit alpha, putative {ECO:0000313|EMBL:CAD51646.2} KW=Complete proteome; Reference proteome OX=36329 OS=Plasmodium falciparum (isolate 3D7). GN=PF3D7_0528500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNNMLNEKKNFIRHVLMNSPPGKLYDLVKDINILLGSSVSIQKILEEVLKDYNEKNYNFI
LTDKNEYVITCKKFKVNHLYFIPKLKALVHVNHLKRTANVLETVKELKYPEQLENYRKEC
DKKLVDYVQEHYKKWSNLQTINYPEVHIKSPNGLRSEHCSSVYAYNEEDIFYLFFIICCD
RSYLKNFHASTWRSSWTAQFFVDNDHVLLSGTIDISLTYFEDANINFKTSKCFEKKVRVN
RDVDMFSSNILSAINEYENYILYDLNNFFTNINKNLIKSTRRIIPLSGQKFDWKGKYEDI
PKQISNS
Download sequence
Identical sequences A0A2I0BU77 Q8I3I2
gi|225631707|emb|CAD51646.2| gi|296004602|ref|XP_001351839.2| PFE1420w XP_001351839.2.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]