SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8X1D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8X1D2
Domain Number 1 Region: 26-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-32
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 148-242
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.7e-22
Family ERP29 C domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8X1D2
Sequence length 249
Comment (tr|Q8X1D2|Q8X1D2_COCIT) Protein disulfide isomerase {ECO:0000313|EMBL:AAL50638.1} OX=5501 OS=Coccidioides immitis (Valley fever fungus). GN=PDI OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
ESLAKFVTDKTGVKPKGIKKAGDSVVKMLTDQSFAKEVGGDKHVFVAFTAPWCGHCKTLA
PTWEALTEDFMREPDVLIAKVDAEAEQSKATARDQKVTGYPTIKFFPKGSKEGETYSGPR
SEDALVNFVNEKCGTHRAVGGGLNAKGGAIEALDDIVARYVSGGAIAEIAKDIKAAAGDL
KQKYAQYYVKVATKLSENSGYAAKELARLEKMKSKGSLAPEKLDDLVSRSNILRRFLGKE
GKKGAKDEL
Download sequence
Identical sequences Q8X1D2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]