SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99L12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99L12
Domain Number 1 Region: 9-87
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-32
Family Capz alpha-1 subunit 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99L12
Sequence length 92
Comment (tr|Q99L12|Q99L12_MOUSE) Capza1 protein {ECO:0000313|EMBL:AAH03915.1} OX=10090 OS=Mus musculus (Mouse). GN=Capza1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
GRVRPRVRNVQLVSHKDVQDSVTVSNEVQTTKEFIKIIESAENEYQTAISENYQTMSDTT
FKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences Q99L12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]