SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9D9A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9D9A5
Domain Number 1 Region: 31-63
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000419
Family Capz beta-1 subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9D9A5
Sequence length 132
Comment (tr|Q9D9A5|Q9D9A5_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAB24898.1} OX=10090 OS=Mus musculus (Mouse). GN=Capzb OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MHPSRRSLPFPLNCQLVRVGTADYGGASEQSDQQLDCALDLMRRLPPQQIEKNLSDLIDL
VRTHLRCSHSSPVRLADPICRAPSVEFKTQETVPLPGHTPPLGSELLPTEKMSFIWWSYS
ESICVGKAHDTH
Download sequence
Identical sequences Q9D9A5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]