SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9HGP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HGP5
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-77
Family Capz beta-1 subunit 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9HGP5
Sequence length 268
Comment (sp|Q9HGP5|CAPZB_SCHPO) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=284812 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). GN=acp2; OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MNSEDAALDLLRRLNPKDISKNLDTILSVAPDLADVLLSSVDQPLKVNTCSESGNQYLLC
DFNRDGDSYRSPWSNKYDPPLEDGLVSTDRVRKLEVSLNEAIRVYLDLYYEGGVSSVYLW
DQDDSYAGAVLIKKASTSNSSGWDSIHVFECLPTTETNVYDYRLTSTIILFLSSGSEEQS
ALPSKALNLSGHLTRQTSQRLPAADDDTEIANVGKLVEEMETRMRNFLQDVYFGKTKDII
NQTRSIQPVSDAQPNDSALRSVLNDLSI
Download sequence
Identical sequences Q9HGP5
4896.SPAC631.01c-1 NP_593619.3.19918 SPAC631.01c___KOG3174 SPAC631_01c.1 SPAC631.01c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]