SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9MYT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9MYT6
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Saposin 0.00000852
Family Swaposin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9MYT6
Sequence length 81
Comment (tr|Q9MYT6|Q9MYT6_PIG) Surfactant protein B {ECO:0000313|EMBL:CAB96174.1} OX=9823 OS=Sus scrofa (Pig). GN=sp-B OC=Sus.
Sequence
FPLVVDHFQSQMNLKAICKHLGLCKPEHPEPGQGPELTGSLLDKLALPLLPAGLQARPGP
QTQDLSKQKFPIPLPFCWLCR
Download sequence
Identical sequences Q9MYT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]