SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9P5K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9P5K9
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-90
Family Capz alpha-1 subunit 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9P5K9
Sequence length 273
Comment (sp|Q9P5K9|CAPZA_NEUCR) F-actin capping protein 1 KW=Complete proteome; Reference proteome OX=367110 OS=1257 / FGSC 987). GN=fac-1; OC=Neurospora.
Sequence
MASHKEIVSSFVEGAPPGELADVVADIKALTSSTPNLLNELGPAFQKYNEEQFTTVKLPG
GSQPVIISSHSSLEDGRYYDVESSSSFAYDHITQKASDVQSHVLEGEQTDLVKSTVKGLS
AYVKEHFPNAAYGAYPIENDTKVAVVIVANKYSPNNFWNGRWRSLYIYDPSNNSIEGSIK
VDVHYYEDGNVRLLTNKTVTATVSSGTGSGIAKEISVNEKKYQEELNKSFTSLSEGAFKG
LRRQLPVTRQKIEWDKVASYRLGQDIGGGSSRR
Download sequence
Identical sequences A0A0B0DJ95 Q9P5K9
XP_957550.2.24337 NCU03911T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]